PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG531100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 218aa    MW: 22670.3 Da    PI: 6.795
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG531100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.39.4e-5820115297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedy+eplk+yl+k+r
  Pavir.2KG531100.1.p  20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYIEPLKLYLHKFR 109
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          elegek
  Pavir.2KG531100.1.p 110 ELEGEK 115
                          ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-5417133IPR009072Histone-fold
SuperFamilySSF471131.23E-4022136IPR009072Histone-fold
PfamPF008086.9E-282589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-205371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-207290No hitNo description
PRINTSPR006151.2E-2091109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MPDSDNESGG PSNAEFSSPR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF  60
ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYIEP LKLYLHKFRE LEGEKVASGA  120
AGSSGSASQP QRETTPSAHN GAAGAVGYGM YGAGAGAGGG SGMIMMMGQP MYGSPPGASG  180
YPQPPHHHMV MGAKGGAYGH GGGSSPSLSG LGRQDRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B6e-4818110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-4818110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4g91_B5e-4820110292Transcription factor HapC (Eurofung)
4g92_B5e-4820110292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.184130.0root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0178300.0BT017830.1 Zea mays clone EL01N0508H10.c mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958263.11e-109PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233109e-72NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLK3ZWT71e-109K3ZWT7_SETIT; Uncharacterized protein
STRINGSi031069m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-72nuclear factor Y, subunit B3